LMO4 Antibody (4H8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related LMO4 Primary Antibodies

Order Details


    • Catalog Number
      H00008543-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LMO4 Antibody (4H8) [DyLight 488] Summary

Immunogen
LMO4 (AAH17673, 1 a.a. - 165 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Specificity
LMO4 (4H8)
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
LMO4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMO4 Antibody (4H8) [DyLight 488]

  • Breast tumor autoantigen
  • Crp3
  • Etohi4
  • LIM domain only 4
  • LIM domain only protein 4
  • LIM domain transcription factor LMO4
  • LMO4
  • LMO-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004004-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
H00055885-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2458
Species: Mu
Applications: WB, IHC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00008543-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for LMO4 Antibody (H00008543-M01G) (0)

There are no publications for LMO4 Antibody (H00008543-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO4 Antibody (H00008543-M01G) (0)

There are no reviews for LMO4 Antibody (H00008543-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMO4 Antibody (H00008543-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO4 Products

Bioinformatics Tool for LMO4 Antibody (H00008543-M01G)

Discover related pathways, diseases and genes to LMO4 Antibody (H00008543-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO4 Antibody (H00008543-M01G)

Discover more about diseases related to LMO4 Antibody (H00008543-M01G).
 

Pathways for LMO4 Antibody (H00008543-M01G)

View related products by pathway.

PTMs for LMO4 Antibody (H00008543-M01G)

Learn more about PTMs related to LMO4 Antibody (H00008543-M01G).
 

Research Areas for LMO4 Antibody (H00008543-M01G)

Find related products by research area.

Blogs on LMO4

There are no specific blogs for LMO4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO4 Antibody (4H8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO4
Entrez