LMO2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LMO2 Antibody [NBP2-58513] - Staining of human cell line REH shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMO2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM
Specificity
Specificity of human LMO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMO2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LMO2 Antibody

  • Cysteine-rich protein TTG-2
  • LIM domain only 2 (rhombotin-like 1)
  • LIM domain only protein 2
  • LMO2
  • LMO-2
  • RBTN2
  • RBTN2rhombotin-2
  • RBTNL1
  • RBTNL1rhombotin-like 1
  • RHOM2
  • RHOM2T-cell translocation protein 2
  • T-cell translocation gene 2
  • TTG2
  • TTG2rhombotin 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47492
Species: Hu, Bb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85573
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004004-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-38611
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2046
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
AF6116
Species: Hu
Applications: WB, ICC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
AF2046
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
NBP2-58513
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for LMO2 Antibody (NBP2-58513) (0)

There are no publications for LMO2 Antibody (NBP2-58513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO2 Antibody (NBP2-58513) (0)

There are no reviews for LMO2 Antibody (NBP2-58513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LMO2 Antibody (NBP2-58513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO2 Products

Bioinformatics Tool for LMO2 Antibody (NBP2-58513)

Discover related pathways, diseases and genes to LMO2 Antibody (NBP2-58513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO2 Antibody (NBP2-58513)

Discover more about diseases related to LMO2 Antibody (NBP2-58513).
 

Pathways for LMO2 Antibody (NBP2-58513)

View related products by pathway.

PTMs for LMO2 Antibody (NBP2-58513)

Learn more about PTMs related to LMO2 Antibody (NBP2-58513).
 

Research Areas for LMO2 Antibody (NBP2-58513)

Find related products by research area.

Blogs on LMO2

There are no specific blogs for LMO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO2