LMO2 Antibody

Images

 
Western Blot: LMO2 Antibody [NBP1-98336] - Antibody Dilution: 1.0ug/ml Sample Tissue: Mouse Testis.

Product Details

Summary
Product Discontinued
View other related LMO2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-98336
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LMO2 Antibody Summary

Immunogen
The immunogen for this antibody is Lmo2- C-terminal region. Peptide sequence RRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLE.
Clonality
Polyclonal
Host
Rabbit
Gene
LMO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LMO2 Antibody

  • Cysteine-rich protein TTG-2
  • LIM domain only 2 (rhombotin-like 1)
  • LIM domain only protein 2
  • LMO2
  • LMO-2
  • RBTN2
  • RBTN2rhombotin-2
  • RBTNL1
  • RBTNL1rhombotin-like 1
  • RHOM2
  • RHOM2T-cell translocation protein 2
  • T-cell translocation gene 2
  • TTG2
  • TTG2rhombotin 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004004-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-82581
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP1-82581
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF3889
Species: Hu, Mu
Applications: WB
MAB23991
Species: Hu
Applications: WB, ICC
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-98336
Species: Mu
Applications: WB

Publications for LMO2 Antibody (NBP1-98336) (0)

There are no publications for LMO2 Antibody (NBP1-98336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMO2 Antibody (NBP1-98336) (0)

There are no reviews for LMO2 Antibody (NBP1-98336). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMO2 Antibody (NBP1-98336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMO2 Antibody Products

Related Products by Gene

Bioinformatics Tool for LMO2 Antibody (NBP1-98336)

Discover related pathways, diseases and genes to LMO2 Antibody (NBP1-98336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMO2 Antibody (NBP1-98336)

Discover more about diseases related to LMO2 Antibody (NBP1-98336).
 

Pathways for LMO2 Antibody (NBP1-98336)

View related products by pathway.

PTMs for LMO2 Antibody (NBP1-98336)

Learn more about PTMs related to LMO2 Antibody (NBP1-98336).

Blogs on LMO2

There are no specific blogs for LMO2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMO2
Entrez
Uniprot