LMAN1L/SLAMP Antibody

Images

 
Immunohistochemistry-Paraffin: LMAN1L Antibody [NBP2-14196] Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Product Discontinued
View other related LMAN1L/SLAMP Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14196
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LMAN1L/SLAMP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLSEPSPEVPPQPFLEMQQLRLARQLEGLWARLGLGTREDVTPKSDSEAQ GEGERLFDLEETLGRHRRILQALRGLSKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMAN1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMAN1L/SLAMP Antibody

  • ERGL
  • lectin, mannose-binding, 1 like
  • LMAN1L
  • SLAMP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-17153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12155
Species: Hu
NBP1-84813
Species: Hu
Applications: IHC, IHC-P
NBL1-12154
Species: Hu
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-45839
Species: Hu
Applications: WB, IHC, IF
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84152
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55973
Species: Hu
Applications: WB, ICC/IF

Publications for LMAN1L/SLAMP Antibody (NBP2-14196) (0)

There are no publications for LMAN1L/SLAMP Antibody (NBP2-14196).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMAN1L/SLAMP Antibody (NBP2-14196) (0)

There are no reviews for LMAN1L/SLAMP Antibody (NBP2-14196). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LMAN1L/SLAMP Antibody (NBP2-14196) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMAN1L/SLAMP Products

LMAN1L/SLAMP NBP2-14196

Bioinformatics Tool for LMAN1L/SLAMP Antibody (NBP2-14196)

Discover related pathways, diseases and genes to LMAN1L/SLAMP Antibody (NBP2-14196). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMAN1L/SLAMP Antibody (NBP2-14196)

Discover more about diseases related to LMAN1L/SLAMP Antibody (NBP2-14196).
 

Pathways for LMAN1L/SLAMP Antibody (NBP2-14196)

View related products by pathway.

PTMs for LMAN1L/SLAMP Antibody (NBP2-14196)

Learn more about PTMs related to LMAN1L/SLAMP Antibody (NBP2-14196).

Blogs on LMAN1L/SLAMP

There are no specific blogs for LMAN1L/SLAMP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMAN1L/SLAMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMAN1L
Entrez