LMAN1 Antibody


Western Blot: LMAN1 Antibody [NBP1-69453] - This Anti-LMAN1 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related LMAN1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LMAN1 Antibody Summary

Synthetic peptides corresponding to LMAN1(lectin, mannose-binding, 1) The peptide sequence was selected from the N terminal of LMAN1. Peptide sequence DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LMAN1 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
LMAN1 Lysate (NBP2-65608)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LMAN1 Antibody

  • ERGIC-53
  • ERGIC53ER-Golgi intermediate compartment 53 kDa protein
  • F5F8Dendoplasmic reticulum-golgi intermediate compartment protein 53
  • FMFD1
  • Gp58
  • intracellular mannose specific lectin
  • Intracellular mannose-specific lectin MR60
  • Lectin mannose-binding 1
  • lectin, mannose-binding, 1
  • MCFD1coagulation factor V-factor VIII combined deficiency
  • MR60
  • protein ERGIC-53


LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.The protein encoded by this gene is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in the gene are associated with a coagulation defect. Using positional cloning, the gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu, Rt, Po, Ch, Rb
Applications: WB, IHC, IP
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB

Publications for LMAN1 Antibody (NBP1-69453) (0)

There are no publications for LMAN1 Antibody (NBP1-69453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMAN1 Antibody (NBP1-69453) (0)

There are no reviews for LMAN1 Antibody (NBP1-69453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMAN1 Antibody (NBP1-69453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional LMAN1 Products

Bioinformatics Tool for LMAN1 Antibody (NBP1-69453)

Discover related pathways, diseases and genes to LMAN1 Antibody (NBP1-69453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMAN1 Antibody (NBP1-69453)

Discover more about diseases related to LMAN1 Antibody (NBP1-69453).

Pathways for LMAN1 Antibody (NBP1-69453)

View related products by pathway.

PTMs for LMAN1 Antibody (NBP1-69453)

Learn more about PTMs related to LMAN1 Antibody (NBP1-69453).

Blogs on LMAN1

There are no specific blogs for LMAN1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LMAN1 Antibody and receive a gift card or discount.


Gene Symbol LMAN1