Recombinant Human LKB1/STK11 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related LKB1/STK11 Peptides and Proteins

Order Details


    • Catalog Number
      H00006794-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human LKB1/STK11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-433 of Human STK11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
STK11

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LKB1/STK11 Protein

  • EC 2.7.11.1
  • LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome)
  • LKB1
  • PJS polarization-related protein LKB1
  • PJS
  • Renal carcinoma antigen NY-REN-19
  • serine/threonine kinase 11
  • serine/threonine-protein kinase 11
  • Serine/threonine-protein kinase LKB1
  • STK11

Background

STK11( AAH07981, 1 a.a. - 434 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24700
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
H00010645-M01
Species: Hu, Mu
Applications: WB, ELISA, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-46234
Species: Hu
Applications: WB, IHC
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-46403
Species: Hu
Applications: IHC
H00006794-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LKB1/STK11 Recombinant Protein (H00006794-P01) (0)

There are no publications for LKB1/STK11 Recombinant Protein (H00006794-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LKB1/STK11 Recombinant Protein (H00006794-P01) (0)

There are no reviews for LKB1/STK11 Recombinant Protein (H00006794-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LKB1/STK11 Recombinant Protein (H00006794-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LKB1/STK11 Products

Bioinformatics Tool for LKB1/STK11 Recombinant Protein (H00006794-P01)

Discover related pathways, diseases and genes to LKB1/STK11 Recombinant Protein (H00006794-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LKB1/STK11 Recombinant Protein (H00006794-P01)

Discover more about diseases related to LKB1/STK11 Recombinant Protein (H00006794-P01).
 

Pathways for LKB1/STK11 Recombinant Protein (H00006794-P01)

View related products by pathway.

PTMs for LKB1/STK11 Recombinant Protein (H00006794-P01)

Learn more about PTMs related to LKB1/STK11 Recombinant Protein (H00006794-P01).
 

Research Areas for LKB1/STK11 Recombinant Protein (H00006794-P01)

Find related products by research area.

Blogs on LKB1/STK11

There are no specific blogs for LKB1/STK11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LKB1/STK11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STK11
Entrez