LKB1/STK11 Antibody

Images

 
Western Blot: LKB1/STK11 Antibody [H00006794-D01P] - Analysis of STK11 expression in transfected 293T cell line by STK11 polyclonal antibody.Lane 1: STK11 transfected lysate(48.60 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: LKB1/STK11 Antibody [H00006794-D01P] - Analysis of rabbit antibody to STK11 on HeLa cell. Antibody concentration 10 ug/ml.
Proximity Ligation Assay: LKB1/STK11 Antibody [H00006794-D01P] - Analysis of protein-protein interactions between STK11 and PRKAA2. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LKB1/STK11 Antibody Summary

Immunogen
STK11 (NP_000446.1, 1 a.a. - 433 a.a.) full-length human protein. MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ
Specificity
STK11 - serine/threonine kinase 11,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LKB1/STK11 Antibody

  • EC 2.7.11.1
  • LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome)
  • LKB1
  • PJS polarization-related protein LKB1
  • PJS
  • Renal carcinoma antigen NY-REN-19
  • serine/threonine kinase 11
  • serine/threonine-protein kinase 11
  • Serine/threonine-protein kinase LKB1
  • STK11

Background

This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24700
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
H00010645-M01
Species: Hu, Mu
Applications: WB, ELISA, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-46234
Species: Hu
Applications: WB, IHC
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-46403
Species: Hu
Applications: IHC
H00006794-D01P
Species: Hu
Applications: WB, ICC/IF, PLA

Publications for LKB1/STK11 Antibody (H00006794-D01P) (0)

There are no publications for LKB1/STK11 Antibody (H00006794-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LKB1/STK11 Antibody (H00006794-D01P) (0)

There are no reviews for LKB1/STK11 Antibody (H00006794-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LKB1/STK11 Antibody (H00006794-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LKB1/STK11 Products

Bioinformatics Tool for LKB1/STK11 Antibody (H00006794-D01P)

Discover related pathways, diseases and genes to LKB1/STK11 Antibody (H00006794-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LKB1/STK11 Antibody (H00006794-D01P)

Discover more about diseases related to LKB1/STK11 Antibody (H00006794-D01P).
 

Pathways for LKB1/STK11 Antibody (H00006794-D01P)

View related products by pathway.

PTMs for LKB1/STK11 Antibody (H00006794-D01P)

Learn more about PTMs related to LKB1/STK11 Antibody (H00006794-D01P).
 

Research Areas for LKB1/STK11 Antibody (H00006794-D01P)

Find related products by research area.

Blogs on LKB1/STK11

There are no specific blogs for LKB1/STK11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LKB1/STK11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK11
Entrez
Uniprot