Livin Recombinant Protein Antigen

Images

 
There are currently no images for Livin Recombinant Protein Antigen (NBP2-56859PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Livin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Livin.

Source: E. coli

Amino Acid Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BIRC7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56859.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Livin Recombinant Protein Antigen

  • baculoviral IAP repeat containing 7
  • baculoviral IAP repeat-containing 7
  • BIRC7
  • KIAP
  • KIAPRING finger protein 50
  • Kidney inhibitor of apoptosis protein
  • livin inhibitor-of-apoptosis
  • Livin
  • Melanoma inhibitor of apoptosis protein
  • ML-IAP
  • MLIAPlivin inhibitor of apoptosis
  • ML-IAPmliap
  • RNF50LIVINbaculoviral IAP repeat-containing protein 7

Background

Livin (BIRC7/KIAP) is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain (reviewed in Ma et al 2006 and Crnkovic-Mertens et al 2006). Resistance towards apoptosis is a hallmark of cancer cells, and overexpression of IAPs can contribute to the development of cancer though inhibiting apoptosis (reviewed in Wright et al. 2005). IAP proteins inhibit apoptosis by binding to and inhibiting caspases through their BIR domain(s). Some IAP members, like Liven, also have a RING-type finger motif at their carboxyl-terminal which may enhance anti-apoptotic activity. Many RING finger-containing IAPs possess E3 ubiquitin ligase activity, and it has been shown that Liven acts an E3 ubiquitin ligase for targeting the degradation of Smac/DIABLO. Smac/DIABLO functions by inhibiting IAP-caspase interactions, thereby promoting apoptosis. Thus degradation of Smac/DIABLO is thought to be a mechanism to enhance Livin anti-apoptotic activity, thereby promoting cell survival. Two splicing variants of Livin, alpha and beta, have been identified. The two isoforms are thought to have different anti-apoptotic properties; however, there are conflicting reports are to whether they actually differ in their biological activities. There is accumulating evidence that Liven plays a significant role in a spectrum of tumor types and it is thought that Liven may have potential as a diagnostic and prognostic tumor marker. Liven is expressed at low levels in adult tissues, and relatively higher levels in developmental tissues and in many cancer cells. Certain cancer patients develop autoantibodies against liven and in a number of cancers, Liven is detected only in the tumors but not, or to substantially lower levels, in the corresponding normal adjacent tissue. This antibody recognizes Livin, both isoform alpha and isoform beta. Human Livin isoform alpha is a 298 amino acid (aa) protein, GenBank no. NP_647478. Human Livin isoform beta is a 280 aa protien, GenBank no. NP_071444.1. The antibody will also recognize other isoforms of Livin that contain the peptide immunogen sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP3-25355
Species: Dr, Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
NBP2-14214
Species: Hu
Applications: IHC,  IHC-P
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF8181
Species: Hu
Applications: IHC, KO, Simple Western, WB
AF8171
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF829
Species: Hu
Applications: WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP2-56859PEP
Species: Hu
Applications: AC

Publications for Livin Recombinant Protein Antigen (NBP2-56859PEP) (0)

There are no publications for Livin Recombinant Protein Antigen (NBP2-56859PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Livin Recombinant Protein Antigen (NBP2-56859PEP) (0)

There are no reviews for Livin Recombinant Protein Antigen (NBP2-56859PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Livin Recombinant Protein Antigen (NBP2-56859PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Livin Products

Research Areas for Livin Recombinant Protein Antigen (NBP2-56859PEP)

Find related products by research area.

Blogs on Livin.

The Ins and Outs of Survivin
By Rachel M.A. Linger, Ph.D.What is survivin?Survivin is a small (16.5 kDa) protein normally found in human fetal tissue. In contrast, survivin is typically undetectable in most normal adult tissues. Expression of ...  Read full blog post.

Survivin - an inhibitor of apoptosis protein
Survivin is an anti-apoptotic protein which is the smallest protein within a large family of proteins including X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, NAIP, and Livin. Survivin is responsible for a wide range of basic cellula...  Read full blog post.

Survivin is thrivin'
The survivin anti-apoptotic protein is the smallest member of a large family of proteins such as X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, Livin, and NAIP. Survivin regulates basic physiological events such as the cell cycle, tumor...  Read full blog post.

Livin: On a Prayer
Livin is a member of the inhibitor of apoptosis proteins (IAP) family that regulates programmed cell death. The Livin protein contains a single baculovirus IAP repeat (BIR) essential for function, along with a COOH-terminal RING-type zinc finger domai...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Livin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BIRC7