Lipin 3 Recombinant Protein Antigen

Images

 
There are currently no images for Lipin 3 Recombinant Protein Antigen (NBP2-57319PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lipin 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lipin 3.

Source: E. coli

Amino Acid Sequence: LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LPIN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57319. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lipin 3 Recombinant Protein Antigen

  • dJ450M14.2
  • dJ450M14.3
  • dJ620E11.2
  • EC 3.1.3.4
  • Lipin 3
  • lipin 3-like
  • lipin-3
  • Lipin-3-like
  • LIPN3L
  • LPIN3
  • phosphatidate phosphatase LPIN3
  • SMP2

Background

Humans lipodystrophy is characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mice carrying mutations in the fatty liver dystrophy (fld) gene have similar phenotypes. Through positional cloning, the mouse gene responsible for fatty liver dystrophy was isolated and designated Lpin1. The nuclear protein encoded by Lpin1 was named lipin. Lpin1 mRNA was expressed at high levels in adipose tissue and was induced during differentiation of preadipocytes. These results indicated that lipin is required for normal adipose tissue development and provided a candidate gene for human lipodystrophy. Through database searches, mouse and human EST and genomic sequences with similarities to Lpin1 were identified. These included two related mouse genes (Lpin2 and Lpin3) and three human homologs (LPIN1, LPIN2, and LPIN3). Human LPIN1 gene has been mapped to 2p25.; linkages of fat mass and serum leptin levels to this same region have been noted. Human LPIN2 and LPIN3 mapped to chromosomes 18p11 and 20q11-q12, respectively. The mouse genes encoding Lpin1, Lpin2, and Lpin3 mapped to chromosome 12, 17, and 2, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57150
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3756
Species: Hu, Mu, Rt
Applications: WB
AF5110
Species: Mu
Applications: IHC, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-56262
Species: Hu
Applications: ICC/IF
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-39092
Species: Hu
Applications: IHC,  IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-57319PEP
Species: Hu
Applications: AC

Publications for Lipin 3 Recombinant Protein Antigen (NBP2-57319PEP) (0)

There are no publications for Lipin 3 Recombinant Protein Antigen (NBP2-57319PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipin 3 Recombinant Protein Antigen (NBP2-57319PEP) (0)

There are no reviews for Lipin 3 Recombinant Protein Antigen (NBP2-57319PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lipin 3 Recombinant Protein Antigen (NBP2-57319PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lipin 3 Products

Blogs on Lipin 3

There are no specific blogs for Lipin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lipin 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LPIN3