Lipase A Antibody

Images

 
Western Blot: Lipase A Antibody [H00003988-B01P] - Analysis of LIPA expression in human pancreas.
Western Blot: Lipase A Antibody [H00003988-B01P] - Analysis of LIPA expression in transfected 293T cell line by LIPA polyclonal antibody. Lane 1: LIPA transfected lysate(43.89 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lipase A Antibody Summary

Immunogen
LIPA (AAH12287.1, 1 a.a. - 399 a.a.) full-length human protein. MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Specificity
LIPA - lipase A, lysosomal acid, cholesterol esterase (Wolman disease),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LIPA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lipase A Antibody

  • Acid cholesteryl ester hydrolase
  • Cholesteryl esterase
  • EC 3.1.1
  • EC 3.1.1.13
  • LALCESDcholesterol ester hydrolase
  • Lipase A
  • lipase A, lysosomal acid, cholesterol esterase
  • lysosomal acid lipase
  • lysosomal acid lipase/cholesteryl ester hydrolase
  • Sterol esterase

Background

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-02948
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
7270-IL/CF
Species: Hu
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB110-40760
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003988-B01P
Species: Hu
Applications: WB

Publications for Lipase A Antibody (H00003988-B01P) (0)

There are no publications for Lipase A Antibody (H00003988-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipase A Antibody (H00003988-B01P) (0)

There are no reviews for Lipase A Antibody (H00003988-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lipase A Antibody (H00003988-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Lipase A Antibody (H00003988-B01P)

Discover related pathways, diseases and genes to Lipase A Antibody (H00003988-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lipase A Antibody (H00003988-B01P)

Discover more about diseases related to Lipase A Antibody (H00003988-B01P).
 

Pathways for Lipase A Antibody (H00003988-B01P)

View related products by pathway.

PTMs for Lipase A Antibody (H00003988-B01P)

Learn more about PTMs related to Lipase A Antibody (H00003988-B01P).

Blogs on Lipase A.

How do Lipase A and the CD36 Antibody Relate to Each Other
Obesity, diabetes and metabolic disorders are dramatically on the increase, linked to disorders such as heart disease, stroke and cancer. To combat this, research groups are studying metabolism at both a cellular and a systemic level. Although we at N...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lipase A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPA
Entrez
Uniprot