LIN52 Antibody

Images

 
Western Blot: LIN52 Antibody [NBP1-88422] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: LIN52 Antibody [NBP1-88422] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIN52 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIN52
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIN52 Protein (NBP1-88422PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIN52 Antibody

  • c14_5549
  • C14orf46
  • chromosome 14 open reading frame 46
  • lin-52 homolog (C. elegans)
  • protein lin-52 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-30384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-80690
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
NBP2-45945
Species: Hu
Applications: WB, Flow, IHC
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NBP2-33794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB200-199
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-88422
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LIN52 Antibody (NBP1-88422) (0)

There are no publications for LIN52 Antibody (NBP1-88422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN52 Antibody (NBP1-88422) (0)

There are no reviews for LIN52 Antibody (NBP1-88422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIN52 Antibody (NBP1-88422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIN52 Products

Bioinformatics Tool for LIN52 Antibody (NBP1-88422)

Discover related pathways, diseases and genes to LIN52 Antibody (NBP1-88422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIN52 Antibody (NBP1-88422)

Discover more about diseases related to LIN52 Antibody (NBP1-88422).
 

Pathways for LIN52 Antibody (NBP1-88422)

View related products by pathway.

PTMs for LIN52 Antibody (NBP1-88422)

Learn more about PTMs related to LIN52 Antibody (NBP1-88422).

Blogs on LIN52

There are no specific blogs for LIN52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIN52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN52