LIN-53 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LIN-53 Antibody [38710002] - This image is specific to animal number SDQ2370 Methanol fixation; 1hr
Immunocytochemistry/ Immunofluorescence: LIN-53 Antibody [38710002] - This image is specific to animal number SDQ2353 Methanol fixation; 1 hr

Product Details

Summary
Reactivity CeSpecies Glossary
Applications ELISA, ICC/IF, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

LIN-53 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
SLSVQWLPDVAKDNSDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKS
Specificity
Caenorhabditis elegans LIN-53
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunoprecipitation
Application Notes
This product is useful for ELISA and for Immunofluorescence. Use in immunoprecipitation reported in scientific literature (PMID 26904949).
Reviewed Applications
Read 1 Review rated 5
using
38710002 in the following applications:

Publications
Read Publication using
38710002 in the following applications:

  • IP
    1 publication

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for LIN-53 Antibody

  • Protein LIN-53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for LIN-53 Antibody (38710002)(1)

We have publications tested in 1 confirmed species: C. elegans.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
C. elegans
(1)
All Species

Review for LIN-53 Antibody (38710002) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Other.
We have 1 review tested in 1 application: WB.

Reviews using 38710002:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot LIN-53 38710002
Enlarge
reviewed by:
Anonymous
WB Other 09/06/2016
View

Summary

ApplicationWestern Blot
SpeciesOther
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LIN-53 Antibody (38710002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIN-53 Products

LIN-53 38710002

Research Areas for LIN-53 Antibody (38710002)

Find related products by research area.

Blogs on LIN-53

There are no specific blogs for LIN-53, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/06/2016
Application: WB
Species: Other

Bioinformatics

Entrez
Uniprot