Recombinant Human LIN-28A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related LIN-28A Peptides and Proteins

Order Details


    • Catalog Number
      P6110
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human LIN-28A Protein Summary

Description
A full-length recombinant protein corresponding to LIN28A (Q9H9Z2).
Epitope
GPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
Preparation
Method
E. coli expression system
Details of Functionality
Measured by its ability to induce fluorescence in Lin28 reporter cells (293 cells transfected with fluorescent protein genes under Lin28 control). Optimum activity was achieved at 20 ug/ml after incubation for 72 hr.
Protein/Peptide Type
Recombinant Protein
Gene
LIN28A
Endotoxin Note
<0.1 ng/ug (<1 EU/ug)

Applications/Dilutions

Theoretical MW
24.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized from 10mM Sodium Citrate, pH 3.0.
Reconstitution Instructions
Reconstitute with water to a final concentration of 1.0 mg/ml. DO NOT VORTEX.

Notes

After reconstituted, dilute further with buffer containing carrier protein and stored in aliquot at -20 to -80C.

Alternate Names for Recombinant Human LIN-28A Protein

  • CSDD1
  • CSDD1lin-28A
  • FLJ12457
  • lin-28 homolog (C. elegans)
  • lin-28 homolog A (C. elegans)
  • LIN28
  • LIN-28
  • LIN28A
  • LIN-28A
  • LIN28RNA-binding protein LIN-28
  • Tex17
  • ZCCHC1
  • ZCCHC1protein lin-28 homolog A
  • Zinc finger CCHC domain-containing protein 1
  • zinc finger, CCHC domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF3158
Species: Mu
Applications: WB, ChIP, ICC
AF7726
Species: Hu
Applications: WB, IHC
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-84863
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LIN-28A Recombinant Protein (P6110) (0)

There are no publications for LIN-28A Recombinant Protein (P6110).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN-28A Recombinant Protein (P6110) (0)

There are no reviews for LIN-28A Recombinant Protein (P6110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for LIN-28A Recombinant Protein (P6110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LIN-28A Products

Bioinformatics Tool for LIN-28A Recombinant Protein (P6110)

Discover related pathways, diseases and genes to LIN-28A Recombinant Protein (P6110). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIN-28A Recombinant Protein (P6110)

Discover more about diseases related to LIN-28A Recombinant Protein (P6110).
 

Pathways for LIN-28A Recombinant Protein (P6110)

View related products by pathway.

PTMs for LIN-28A Recombinant Protein (P6110)

Learn more about PTMs related to LIN-28A Recombinant Protein (P6110).
 

Research Areas for LIN-28A Recombinant Protein (P6110)

Find related products by research area.

Blogs on LIN-28A

There are no specific blogs for LIN-28A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LIN-28A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN28A
Entrez