LIM1 Antibody (2A7)

Images

 
There are currently no images for LIM1 Antibody (H00003975-M07).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LIM1 Antibody (2A7) Summary

Immunogen
LHX1 (NP_005559, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST
Specificity
LHX1 (2A7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LHX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LIM1 Antibody (2A7)

  • hLim-1
  • Homeobox protein Lim-1
  • LHX1
  • LIM homeobox 1
  • LIM homeobox protein 1
  • LIM1
  • LIM-1LIM/homeobox protein Lhx1
  • LIM1MGC138141
  • MGC126723

Background

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
AF475
Species: Mu
Applications: WB, IHC
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
AF2400
Species: Hu
Applications: WB, ChIP, ICC
H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6290
Species: Hu, Mu, Rt
Applications: WB, IHC
423-F8/CF
Species: Hu, Mu
AF1075
Species: Hu
Applications: WB
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00003975-M07
Species: Hu
Applications: WB, ELISA

Publications for LIM1 Antibody (H00003975-M07) (0)

There are no publications for LIM1 Antibody (H00003975-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIM1 Antibody (H00003975-M07) (0)

There are no reviews for LIM1 Antibody (H00003975-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIM1 Antibody (H00003975-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIM1 Products

Bioinformatics Tool for LIM1 Antibody (H00003975-M07)

Discover related pathways, diseases and genes to LIM1 Antibody (H00003975-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIM1 Antibody (H00003975-M07)

Discover more about diseases related to LIM1 Antibody (H00003975-M07).
 

Pathways for LIM1 Antibody (H00003975-M07)

View related products by pathway.

PTMs for LIM1 Antibody (H00003975-M07)

Learn more about PTMs related to LIM1 Antibody (H00003975-M07).
 

Research Areas for LIM1 Antibody (H00003975-M07)

Find related products by research area.

Blogs on LIM1

There are no specific blogs for LIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIM1 Antibody (2A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX1
Entrez
OMIM
Uniprot