Recombinant Human LIGHT/TNFSF14 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related LIGHT/TNFSF14 Peptides and Proteins

Order Details


    • Catalog Number
      H00008740-P02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human LIGHT/TNFSF14 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-204 of Human TNFSF14 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
TNFSF14

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LIGHT/TNFSF14 Protein

  • CD258 antigen
  • CD258
  • delta transmembrane LIGHT
  • Herpes virus entry mediator ligand
  • Herpesvirus entry mediator ligand
  • HVEM-L
  • HVEMLherpesvirus entry mediator-ligand
  • ligand for herpesvirus entry mediator
  • LIGHT
  • LIGHTherpesvirus entry mediator A
  • LTg
  • TNFSF14
  • TR2
  • tumor necrosis factor (ligand) superfamily, member 14
  • tumor necrosis factor ligand superfamily member 14
  • tumor necrosis factor receptor-like 2
  • tumor necrosis factor superfamily member LIGHT

Background

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF1936
Species: Hu
Applications: WB, IP
H00008740-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02) (0)

There are no publications for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02) (0)

There are no reviews for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LIGHT/TNFSF14 Products

Bioinformatics Tool for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02)

Discover related pathways, diseases and genes to LIGHT/TNFSF14 Recombinant Protein (H00008740-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02)

Discover more about diseases related to LIGHT/TNFSF14 Recombinant Protein (H00008740-P02).
 

Pathways for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02)

View related products by pathway.

PTMs for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02)

Learn more about PTMs related to LIGHT/TNFSF14 Recombinant Protein (H00008740-P02).
 

Research Areas for LIGHT/TNFSF14 Recombinant Protein (H00008740-P02)

Find related products by research area.

Blogs on LIGHT/TNFSF14

There are no specific blogs for LIGHT/TNFSF14, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LIGHT/TNFSF14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF14
Entrez