LIG1 Antibody

Images

 
Immunohistochemistry: LIG1 Antibody [NBP2-32603] - Staining of human duodenum shows distinct nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LIG1 Protein (NBP2-32603PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIG1 Antibody

  • Leucine-Rich Repeat Protein LRIG1
  • Leucine-Rich Repeats And Immunoglobulin-Like Domains 1
  • Leucine-Rich Repeats And Immunoglobulin-Like Domains Protein 1
  • LIG-1
  • LRIG1
  • Ortholog Of Mouse Integral Membrane Glycoprotein LIG-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF3495
Species: Hu
Applications: WB, IHC
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-119
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-41190
Species: Hu, Mu, Ch
Applications: WB, B/N, ICC/IF, IP, PLA
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP2-16372
Species: Hu
Applications: WB, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NBP1-41190
Species: Hu, Mu, Ch
Applications: WB, B/N, ICC/IF, IP, PLA
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83420
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for LIG1 Antibody (NBP2-32603) (0)

There are no publications for LIG1 Antibody (NBP2-32603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIG1 Antibody (NBP2-32603) (0)

There are no reviews for LIG1 Antibody (NBP2-32603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LIG1 Antibody (NBP2-32603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIG1 Antibody and receive a gift card or discount.