LHFPL4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LHFPL4 Antibody [NBP1-86225] - Staining of human cell line A-431 shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: LHFPL4 Antibody [NBP1-86225] - Staining of human vagina shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LHFPL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LHFPL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LHFPL4 Protein (NBP1-86225PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LHFPL4 Antibody

  • LHFP-like protein 4
  • lipoma HMGIC fusion partner-like 4 protein
  • lipoma HMGIC fusion partner-like 4
  • MGC133162

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-57244
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57678
Species: Hu
Applications: ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P

Publications for LHFPL4 Antibody (NBP1-86225) (0)

There are no publications for LHFPL4 Antibody (NBP1-86225).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHFPL4 Antibody (NBP1-86225) (0)

There are no reviews for LHFPL4 Antibody (NBP1-86225). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LHFPL4 Antibody (NBP1-86225) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LHFPL4 Products

LHFPL4 NBP1-86225

Bioinformatics Tool for LHFPL4 Antibody (NBP1-86225)

Discover related pathways, diseases and genes to LHFPL4 Antibody (NBP1-86225). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHFPL4 Antibody (NBP1-86225)

Discover more about diseases related to LHFPL4 Antibody (NBP1-86225).
 

Pathways for LHFPL4 Antibody (NBP1-86225)

View related products by pathway.

PTMs for LHFPL4 Antibody (NBP1-86225)

Learn more about PTMs related to LHFPL4 Antibody (NBP1-86225).

Blogs on LHFPL4

There are no specific blogs for LHFPL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LHFPL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LHFPL4