Leupaxin Antibody

Images

 
Independent Antibodies: Western Blot: Leupaxin Antibody [NBP2-31078] - Analysis using Anti-LPXN antibody NBP2-31078 (A) shows similar pattern to independent antibody NBP2-55850 (B).
Immunohistochemistry-Paraffin: Leupaxin Antibody [NBP2-31078] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells, germinal center cells were moderately stained.
Orthogonal Strategies: Western Blot: Leupaxin Antibody [NBP2-31078] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPXN antibody. Corresponding LPXN RNA-seq data are presented for the same cell lines. ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Leupaxin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPXN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Leupaxin Protein (NBP2-31078PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Leupaxin Antibody

  • LDLP
  • LDPL
  • leupaxin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-60666
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-1269
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-34260
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
DCRP00
Species: Hu
Applications: ELISA
AF5626
Species: Hu
Applications: ICC, WB
NBP2-20454
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DKK300
Species: Hu
Applications: ELISA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-85466
Species: Fe, Hu, Mu
Applications: IHC, IHC-P, WB
AF7895
Species: Hu
Applications: IHC, WB
NB600-1293
Species: Am, Bv, Ca, Ch, Hu, Mu, Rt, Tr
Applications: ICC/IF, IHC, IHC-Fr, Simple Western, Single-Cell Western, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB

Publications for Leupaxin Antibody (NBP2-31078) (0)

There are no publications for Leupaxin Antibody (NBP2-31078).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Leupaxin Antibody (NBP2-31078) (0)

There are no reviews for Leupaxin Antibody (NBP2-31078). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Leupaxin Antibody (NBP2-31078) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Leupaxin Products

Bioinformatics Tool for Leupaxin Antibody (NBP2-31078)

Discover related pathways, diseases and genes to Leupaxin Antibody (NBP2-31078). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Leupaxin Antibody (NBP2-31078)

Discover more about diseases related to Leupaxin Antibody (NBP2-31078).
 

Pathways for Leupaxin Antibody (NBP2-31078)

View related products by pathway.

PTMs for Leupaxin Antibody (NBP2-31078)

Learn more about PTMs related to Leupaxin Antibody (NBP2-31078).

Blogs on Leupaxin

There are no specific blogs for Leupaxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Leupaxin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPXN