LETM1 Antibody (6F7) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related LETM1 Primary Antibodies

Order Details


    • Catalog Number
      H00003954-M03PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LETM1 Antibody (6F7) [PerCP] Summary

Immunogen
LETM1 (NP_036450 601 a.a. - 708 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA
Specificity
LETM1 - leucine zipper-EF-hand containing transmembrane protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LETM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LETM1 Antibody (6F7) [PerCP]

  • LETM1 and EF-hand domain-containing protein 1, mitochondrial
  • leucine zipper-EF-hand containing transmembrane protein 1
  • Leucine zipper-EF-hand-containing transmembrane protein 1
  • Mdm38 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52963
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86663
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-57582
Species: Hu
Applications: ICC/IF
NBP2-37394
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-77360
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00007109-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-88534
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06255
Species: Hu
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF

Publications for LETM1 Antibody (H00003954-M03PCP) (0)

There are no publications for LETM1 Antibody (H00003954-M03PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LETM1 Antibody (H00003954-M03PCP) (0)

There are no reviews for LETM1 Antibody (H00003954-M03PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LETM1 Antibody (H00003954-M03PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LETM1 Products

Bioinformatics Tool for LETM1 Antibody (H00003954-M03PCP)

Discover related pathways, diseases and genes to LETM1 Antibody (H00003954-M03PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LETM1 Antibody (H00003954-M03PCP)

Discover more about diseases related to LETM1 Antibody (H00003954-M03PCP).
 

Pathways for LETM1 Antibody (H00003954-M03PCP)

View related products by pathway.

PTMs for LETM1 Antibody (H00003954-M03PCP)

Learn more about PTMs related to LETM1 Antibody (H00003954-M03PCP).

Blogs on LETM1

There are no specific blogs for LETM1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LETM1 Antibody (6F7) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol LETM1