Leptin/OB Antibody (3G1-1C9)

Images

 
Sandwich ELISA: Leptin/OB Antibody (3G1-1C9) [H00003952-M01] - Detection limit for recombinant GST tagged LEP is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G1-1C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Leptin/OB Antibody (3G1-1C9) Summary

Immunogen
LEP (AAH60830.1, 22 a.a. - 167 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Localization
Secreted
Specificity
LEP - leptin (obesity homolog, mouse)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LEP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Leptin/OB Antibody (3G1-1C9)

  • FLJ94114
  • LEP
  • leptin (murine obesity homolog)
  • leptin (obesity homolog, mouse)
  • Leptin
  • OB
  • Obese protein
  • obese, mouse, homolog of
  • Obesity factor
  • OBOBS

Background

This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB8200
Species: Hu, Mu
Applications: IHC
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for Leptin/OB Antibody (H00003952-M01) (0)

There are no publications for Leptin/OB Antibody (H00003952-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Leptin/OB Antibody (H00003952-M01) (0)

There are no reviews for Leptin/OB Antibody (H00003952-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Leptin/OB Antibody (H00003952-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Leptin/OB Products

Bioinformatics Tool for Leptin/OB Antibody (H00003952-M01)

Discover related pathways, diseases and genes to Leptin/OB Antibody (H00003952-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Leptin/OB Antibody (H00003952-M01)

Discover more about diseases related to Leptin/OB Antibody (H00003952-M01).
 

Pathways for Leptin/OB Antibody (H00003952-M01)

View related products by pathway.

PTMs for Leptin/OB Antibody (H00003952-M01)

Learn more about PTMs related to Leptin/OB Antibody (H00003952-M01).
 

Research Areas for Leptin/OB Antibody (H00003952-M01)

Find related products by research area.

Blogs on Leptin/OB

There are no specific blogs for Leptin/OB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Leptin/OB Antibody (3G1-1C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol LEP
Entrez
OMIM
Uniprot