Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen

Images

 
There are currently no images for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGMN.

Source: E.coli

Amino Acid Sequence: QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY

Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGMN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55139. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen

  • AEP
  • Asparaginyl Endopeptidase
  • cysteine protease 1
  • Legumain
  • LGMN
  • LGMN1
  • Protease, cysteine 1
  • protease, cysteine, 1 (legumain)
  • PRSC1EC 3.4.22.34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00008706-P01
Species: Hu
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP1-87782
Species: Hu
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-55139PEP
Species: Hu
Applications: AC

Publications for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP) (0)

There are no publications for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP) (0)

There are no reviews for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP)

Discover related pathways, diseases and genes to Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP)

Discover more about diseases related to Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP).
 

Pathways for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP)

View related products by pathway.

Research Areas for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen (NBP2-55139PEP)

Find related products by research area.

Blogs on Legumain/Asparaginyl Endopeptidase

There are no specific blogs for Legumain/Asparaginyl Endopeptidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LGMN
Entrez