Lefty-B Antibody (4D7)

Images

 
Immunoprecipitation: Lefty-B Antibody (4D7) [H00010637-M01] - Analysis of LEFTY1 transfected lysate using anti-LEFTY1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LEFTY1 MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
4D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lefty-B Antibody (4D7) Summary

Immunogen
LEFTY1 (AAH27883, 1 a.a. ~ 367 a.a) full length recombinant protein with GST tag.MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPT LDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFRE VAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVP KAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLV SVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGP LASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDY
Localization
Secreted
Specificity
LEFTY1 - left-right determination factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LEFTY1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lefty-B Antibody (4D7)

  • LEFTBProtein lefty-B
  • left-right determination factor 1
  • Left-right determination factor B
  • left-right determination, factor B
  • LEFTYBProtein lefty-1

Background

This gene encodes a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF746
Species: Hu, Mu
Applications: WB
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF1075
Species: Hu
Applications: WB
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
MAB18401
Species: Mu
Applications: WB, Flow, ICC
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF4248
Species: Hu
Applications: WB, ICC
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
H00010637-M01
Species: Hu
Applications: ELISA, IP

Publications for Lefty-B Antibody (H00010637-M01) (0)

There are no publications for Lefty-B Antibody (H00010637-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lefty-B Antibody (H00010637-M01) (0)

There are no reviews for Lefty-B Antibody (H00010637-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lefty-B Antibody (H00010637-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lefty-B Products

Bioinformatics Tool for Lefty-B Antibody (H00010637-M01)

Discover related pathways, diseases and genes to Lefty-B Antibody (H00010637-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lefty-B Antibody (H00010637-M01)

Discover more about diseases related to Lefty-B Antibody (H00010637-M01).
 

Pathways for Lefty-B Antibody (H00010637-M01)

View related products by pathway.

PTMs for Lefty-B Antibody (H00010637-M01)

Learn more about PTMs related to Lefty-B Antibody (H00010637-M01).
 

Research Areas for Lefty-B Antibody (H00010637-M01)

Find related products by research area.

Blogs on Lefty-B

There are no specific blogs for Lefty-B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lefty-B Antibody (4D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol LEFTY1
Entrez
OMIM
Uniprot