LEF1 Antibody

Images

 
Western Blot: LEF1 Antibody [NBP1-74095] - 293T cell lysate, 1.0 ug/ml
Western Blot: LEF1 Antibody [NBP1-74095] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related LEF1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74095
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LEF1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of LEF1. Immunizing peptide sequence ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG.
Clonality
Polyclonal
Host
Rabbit
Gene
LEF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LEF1 and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LEF1 Antibody

  • DKFZp586H0919
  • FLJ46390
  • LEF1
  • LEF-1
  • lymphoid enhancer-binding factor 1
  • T cell-specific transcription factor 1-alpha
  • TCF10
  • TCF1ALPHA
  • TCF1-alpha
  • TCF7L3

Background

Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF5596
Species: Hu
Applications: WB, IHC, ICC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF1620
Species: Mu
Applications: WB, IHC
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-74095
Species: Hu
Applications: WB

Publications for LEF1 Antibody (NBP1-74095) (0)

There are no publications for LEF1 Antibody (NBP1-74095).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEF1 Antibody (NBP1-74095) (0)

There are no reviews for LEF1 Antibody (NBP1-74095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEF1 Antibody (NBP1-74095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LEF1 Products

Bioinformatics Tool for LEF1 Antibody (NBP1-74095)

Discover related pathways, diseases and genes to LEF1 Antibody (NBP1-74095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEF1 Antibody (NBP1-74095)

Discover more about diseases related to LEF1 Antibody (NBP1-74095).
 

Pathways for LEF1 Antibody (NBP1-74095)

View related products by pathway.

PTMs for LEF1 Antibody (NBP1-74095)

Learn more about PTMs related to LEF1 Antibody (NBP1-74095).
 

Research Areas for LEF1 Antibody (NBP1-74095)

Find related products by research area.

Blogs on LEF1.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LEF1
Entrez
Uniprot