LECT2 Partial Protein

Images

 
There are currently no images for LECT2 Partial Recombinant Protein (H00003950-Q01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

LECT2 Partial Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 76 - 151 of Human LECT2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYL

Protein/Peptide Type
Partial Protein
Gene
LECT2

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LECT2 Partial Protein

  • chm2
  • chm-II
  • Chondromodulin II
  • chondromodulin-II
  • hLECT2
  • LECT2
  • LECT-2
  • leukocyte cell-derived chemotaxin 2
  • leukocyte cell-derived chemotaxin-2
  • MGC126628
  • MIM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB41681
Species: Hu
Applications: WB
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
AF4409
Species: Mu
Applications: WB
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
126-FL/CF
Species: Hu
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for LECT2 Partial Recombinant Protein (H00003950-Q01) (0)

There are no publications for LECT2 Partial Recombinant Protein (H00003950-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LECT2 Partial Recombinant Protein (H00003950-Q01) (0)

There are no reviews for LECT2 Partial Recombinant Protein (H00003950-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LECT2 Partial Recombinant Protein (H00003950-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LECT2 Products

Bioinformatics Tool for LECT2 Partial Recombinant Protein (H00003950-Q01)

Discover related pathways, diseases and genes to LECT2 Partial Recombinant Protein (H00003950-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LECT2 Partial Recombinant Protein (H00003950-Q01)

Discover more about diseases related to LECT2 Partial Recombinant Protein (H00003950-Q01).
 

Pathways for LECT2 Partial Recombinant Protein (H00003950-Q01)

View related products by pathway.

PTMs for LECT2 Partial Recombinant Protein (H00003950-Q01)

Learn more about PTMs related to LECT2 Partial Recombinant Protein (H00003950-Q01).

Blogs on LECT2

There are no specific blogs for LECT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LECT2 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LECT2
Entrez