LDL R Antibody (5E7.)

Images

 
Western Blot: LDL R Antibody (5E7) [H00003949-M01] - Analysis of LDLR expression in transfected 293T cell line by LDLR monoclonal antibody (M01), clone 5E7.Lane 1: LDLR transfected lysate(94.6 KDa).Lane 2: ...read more
ELISA: LDL R Antibody (5E7.) [H00003949-M01] - LDL R Antibody (5E7) [H00003949-M01] - Detection limit for recombinant GST tagged LDLR is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LDL R Antibody (5E7.) Summary

Immunogen
LDLR (NP_000518, 105 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL
Specificity
LDLR - low density lipoprotein receptor (familial hypercholesterolemia)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LDLR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. It has been used for WB.
Publications
Read Publication using H00003949-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LDL R Antibody (5E7.)

  • FH
  • FHC
  • LDL R
  • LDL receptor
  • LDLCQ2
  • LDLR
  • low density lipoprotein receptor
  • low-density lipoprotein receptor class A domain-containing protein 3
  • low-density lipoprotein receptor

Background

The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-527
Species: Hu, Mu
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF4779
Species: Hu
Applications: WB, IHC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for LDL R Antibody (H00003949-M01)(1)

Reviews for LDL R Antibody (H00003949-M01) (0)

There are no reviews for LDL R Antibody (H00003949-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LDL R Antibody (H00003949-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LDL R Products

Bioinformatics Tool for LDL R Antibody (H00003949-M01)

Discover related pathways, diseases and genes to LDL R Antibody (H00003949-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LDL R Antibody (H00003949-M01)

Discover more about diseases related to LDL R Antibody (H00003949-M01).
 

Pathways for LDL R Antibody (H00003949-M01)

View related products by pathway.

PTMs for LDL R Antibody (H00003949-M01)

Learn more about PTMs related to LDL R Antibody (H00003949-M01).
 

Research Areas for LDL R Antibody (H00003949-M01)

Find related products by research area.

Blogs on LDL R

There are no specific blogs for LDL R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LDL R Antibody (5E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol LDLR
Entrez
Uniprot