LDHAL6B Antibody (1A3)

Images

 
Western Blot: LDHAL6B Antibody (1A3) [H00092483-M01] - Analysis of LDHAL6B expression in transfected 293T cell line by LDHAL6B monoclonal antibody (M01), clone 1A3.Lane 1: LDHAL6B transfected lysate (Predicted MW: 42 ...read more
Sandwich ELISA: LDHAL6B Antibody (1A3) [H00092483-M01] - Detection limit for recombinant GST tagged LDHAL6B is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LDHAL6B Antibody (1A3) Summary

Immunogen
LDHAL6B (NP_005497, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTITKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPEEEAHLKKSAKTLWEIQNKLKL
Specificity
LDHAL6B (1A3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LDHAL6B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LDHAL6B Antibody (1A3)

  • EC 1.1.1
  • lactate dehydrogenase A-like 6
  • lactate dehydrogenase A-like 6B
  • LDH6B
  • LDHAL6
  • LDHLEC 1.1.1.27
  • L-lactate dehydrogenase A-like 6B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48336
Species: Hu, Mu, Po, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-67309
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-55415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, S-ELISA, KD
NB100-68159
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-13075
Species: Hu, Mu, Rt, Ba, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85871
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47801
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00092483-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for LDHAL6B Antibody (H00092483-M01) (0)

There are no publications for LDHAL6B Antibody (H00092483-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDHAL6B Antibody (H00092483-M01) (0)

There are no reviews for LDHAL6B Antibody (H00092483-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LDHAL6B Antibody (H00092483-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LDHAL6B Products

Bioinformatics Tool for LDHAL6B Antibody (H00092483-M01)

Discover related pathways, diseases and genes to LDHAL6B Antibody (H00092483-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LDHAL6B

There are no specific blogs for LDHAL6B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LDHAL6B Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHAL6B
Entrez
Uniprot