LCN6 Antibody - Azide and BSA Free

Images

 
Western Blot: LCN6 Antibody [NBP3-04897] - Analysis of extracts of mouse testis, using LCN6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more

Product Details

Summary
Reactivity Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

LCN6 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-120 of human LCN6 (NP_945184.1). RLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAII
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCN6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for LCN6 Antibody - Azide and BSA Free

  • epididymal-specific lipocalin LCN6
  • epididymal-specific lipocalin-6
  • hLcn5
  • LCN5
  • lipocalin 5
  • lipocalin 6
  • lipocalin-5
  • UNQ643

Background

LCN6 may play a role in male fertility

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LCN6 Antibody (NBP3-04897) (0)

There are no publications for LCN6 Antibody (NBP3-04897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LCN6 Antibody (NBP3-04897) (0)

There are no reviews for LCN6 Antibody (NBP3-04897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCN6 Antibody (NBP3-04897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LCN6 Products

Array NBP3-04897

Research Areas for LCN6 Antibody (NBP3-04897)

Find related products by research area.

Blogs on LCN6

There are no specific blogs for LCN6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCN6 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol LCN6