LCLAT1 Antibody

Images

 
Western Blot: LCLAT1 Antibody [NBP1-59347] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: LCLAT1 Antibody [NBP1-59347] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: LCLAT1 Antibody [NBP1-59347] - Sample Tissue: Human 721_B cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LCLAT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to LYCAT(lysocardiolipin acyltransferase) The peptide sequence was selected from the middle region of human LYCAT. Peptide sequence YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCLAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against LYCAT and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-59347.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LCLAT1 Antibody

  • 1-acylglycerol-3-phosphate O-acyltransferase 8
  • 1-AGPAT 8
  • Acyl-CoA:lysocardiolipin acyltransferase 1
  • AGPAT8lysocardiolipin acyltransferase
  • ALCAT11AGPAT8
  • EC 2.3.1.-
  • EC 2.3.1.51
  • FLJ37965
  • HSRG1849
  • LYCAT
  • lysocardiolipin acyltransferase 1
  • UNQ1849,1-AGP acyltransferase 8

Background

LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44814
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IF
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59856
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-59478
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00055669-M04
Species: Hu, Mu
Applications: WB, ELISA, Flow
NBP1-83929
Species: Hu
Applications: IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-13245
Species: Hu
Applications: IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
H00010162-P01
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-69686
Species: Hu, Mu, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-59347
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB

Publications for LCLAT1 Antibody (NBP1-59347)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for LCLAT1 Antibody (NBP1-59347) (0)

There are no reviews for LCLAT1 Antibody (NBP1-59347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCLAT1 Antibody (NBP1-59347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LCLAT1 Products

Bioinformatics Tool for LCLAT1 Antibody (NBP1-59347)

Discover related pathways, diseases and genes to LCLAT1 Antibody (NBP1-59347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LCLAT1

There are no specific blogs for LCLAT1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCLAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCLAT1
Entrez
Uniprot