Lck Antibody (3H5)

Images

 
Western Blot: Lck Antibody (3H5) [H00003932-M11] - Analysis of LCK expression in transfected 293T cell line by LCK monoclonal antibody (M11), clone 3H5. Lane 1: LCK transfected lysatE (58.001 KDa). Lane 2: ...read more
ELISA: Lck Antibody (3H5) [H00003932-M11] - Detection limit for recombinant GST tagged LCK is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lck Antibody (3H5) Summary

Immunogen
LCK (AAH13200, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKA
Specificity
LCK - lymphocyte-specific protein tyrosine kinase (3H5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LCK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lck Antibody (3H5)

  • EC 2.7.10
  • EC 2.7.10.2
  • Hck-3
  • Lck
  • Lcktkr
  • Leukocyte C-terminal Src kinase
  • LSK
  • LSTRA
  • Lymphocyte cell-specific protein-tyrosine kinase
  • lymphocyte-specific protein tyrosine kinase
  • p56(LSTRA) protein-tyrosine kinase
  • p56lck
  • p56-LCK
  • pp58lck
  • Protein YT16
  • Proto-oncogene Lck
  • proto-oncogene tyrosine-protein kinase LCK
  • T cell-specific protein-tyrosine kinase
  • T-lymphocyte specific protein tyrosine kinase p56lck
  • tyrosine-protein kinase Lck
  • YT16

Background

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46218
Species: Hu
Applications: WB, IHC
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84084
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for Lck Antibody (H00003932-M11) (0)

There are no publications for Lck Antibody (H00003932-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lck Antibody (H00003932-M11) (0)

There are no reviews for Lck Antibody (H00003932-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lck Antibody (H00003932-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lck Products

Bioinformatics Tool for Lck Antibody (H00003932-M11)

Discover related pathways, diseases and genes to Lck Antibody (H00003932-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lck Antibody (H00003932-M11)

Discover more about diseases related to Lck Antibody (H00003932-M11).
 

Pathways for Lck Antibody (H00003932-M11)

View related products by pathway.

PTMs for Lck Antibody (H00003932-M11)

Learn more about PTMs related to Lck Antibody (H00003932-M11).
 

Research Areas for Lck Antibody (H00003932-M11)

Find related products by research area.

Blogs on Lck

There are no specific blogs for Lck, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lck Antibody (3H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol LCK
Entrez
Uniprot