| Description | A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-125 of Human MAP1LC3B full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
| Immunogen | Human MAP1LC3B full-length ORF ( AAH18634, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. Sequence:MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
| Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type | Recombinant Protein |
| Gene | MAP1LC3B |
| Dilutions |
|
|
| Application Notes | Useful in Western Blot , Protein Array, Antibody Production and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. Use in Western Blot reported in scientific literature (PMID 24722179) |
|
| Theoretical MW | 39.49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
Research Areas for LC3B Recombinant Protein (H00081631-P01)Find related products by research area.
|
|
Autophagy and RAS signaling: Clinical implications By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ... Read full blog post. |
|
Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm... Read full blog post. |
|
Autophagy and Metastasis By Christina Towers, PhD The majority of cancer patients die from metastatic disease at secondary sites. The threshold to undergo metastasis is high. Only a minority of cancer cells acquire invasive phenotypes... Read full blog post. |
|
Optogenetic Control of Mitophagy: AMBRA1 based mitophagy switch By Christina Towers, PhD Mitophagy in the BrainSelective autophagic degradation of damaged mitochondria, known as mitophagy, has been described as a cyto-protective process. Accordingly, defects in mitophagy h... Read full blog post. |
|
Read full blog post. |
|
Read full blog post. |
|
Read full blog post. |
|
How to visualize autophagy by microscopy By Christina Towers, PhD Autophagy is a recycling process that relies on the formation of a unique organelle termed an autophagosome. An elegant way to monitor autophagy is through various microscopy techniques to... Read full blog post. |
|
Read full blog post. |
|
Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAP1LC3B |