LC3B Antibody (4E11)

Images

 
Sandwich ELISA: LC3B/MAP1LC3B Antibody (4E11) [H00081631-M01] - Detection limit for recombinant GST tagged MAP1LC3B is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related LC3B Primary Antibodies

Order Details


    • Catalog Number
      H00081631-M01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LC3B Antibody (4E11) Summary

Immunogen
MAP1LC3B (NP_073729, 1 a.a. ~ 71a.a) partial recombinant protein with GST tag. MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL
Marker
Autophagosome Marker
Specificity
MAP1LC3B - microtubule-associated protein 1 light chain 3 beta.H00081631-M01.MW of the GST tag alone is 26 KDa.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP1LC3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.
Positive Control
Brain Cerebral Cortex Lysate (NB820-59182)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LC3B Antibody (4E11)

  • Apg8b
  • ATG8F
  • Autophagy-related protein LC3 B
  • Autophagy-related ubiquitin-like modifier LC3 B
  • lc3b autophagy marker
  • LC3B
  • lc3-i, ii
  • LC3II
  • MAP1 light chain 3-like protein 2
  • MAP1A/1BLC3
  • MAP1A/MAP1B LC3 B
  • MAP1LC3B
  • microtubule associated protein 3 b
  • microtubule associated protein 3 beta
  • microtubule-associated protein 1 light chain 3 betaMAP1A/MAP1B light chain 3 B
  • microtubule-associated proteins 1A/1B light chain 3
  • microtubule-associated proteins 1A/1B light chain 3B

Background

The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-57604
Species: Hu
Applications: ICC/IF
H00081631-M01
Species: Hu
Applications: ELISA

Publications for LC3B Antibody (H00081631-M01) (0)

There are no publications for LC3B Antibody (H00081631-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LC3B Antibody (H00081631-M01) (0)

There are no reviews for LC3B Antibody (H00081631-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LC3B Antibody (H00081631-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional LC3B Products

Bioinformatics Tool for LC3B Antibody (H00081631-M01)

Discover related pathways, diseases and genes to LC3B Antibody (H00081631-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LC3B Antibody (H00081631-M01)

Discover more about diseases related to LC3B Antibody (H00081631-M01).
 

Pathways for LC3B Antibody (H00081631-M01)

View related products by pathway.

PTMs for LC3B Antibody (H00081631-M01)

Learn more about PTMs related to LC3B Antibody (H00081631-M01).
 

Research Areas for LC3B Antibody (H00081631-M01)

Find related products by research area.

Blogs on LC3B.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants; LC3A, LC3B and LC3C (He et al., 2003). LC3B is a subunit of the MAP1A and MAP1B microtubule-binding pr...  Read full blog post.

LC3B: From Autophagy to Cancer
LC3B is subunit component of the LC3 autophagy biomarker associated with microtubule-associated proteins MAP1A and MAP1B and one of the best characterized markers to date. In resting state it is cytosolic, but upon activation, is lapidated and becomes...  Read full blog post.

LC3B Empowers Protein Quality Control by Autophagy
LC3B also known as microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) is an autophagy gene that contributes appreciably to protein degradation. Autophagy is a highly synchronized and a dynamic catabolic degradation activity that plays an e...  Read full blog post.

Analyzing LC3 in Western blot
Microtubule-associated protein light chain 3 (LC3) is considered one of the definitive markers of autophagy, and its use is widespread in labs throughout the world. Despite its popularity, there are several considerations when employing LC3 antibodies...  Read full blog post.

Marking the Autophagosome: the LC3 Antibody
MAP1LC3 (shortened to LC3 in our antibody catalog) is one of four mammalian homologues of autophagy-related protein 8 (Atg8). It has been identified as a light chain subunit of the microtubule-associated proteins MAP1A/MAP1B. A modified form of LC3, L...  Read full blog post.

Breakdown: Interpreting LC3 Antibody WB Results
In rodents, MAPLC3 (Microtubule-associated protein 1 light chain 3) is expressed in the renal visceral epithelial cells, or podocytes. LC3 antibody analysis has shown the protein accumulates in its membrane-bound form of LC3II, following conversion fr...  Read full blog post.

The Role of LC3 within the Autophagic Pathway
We at Novus Biologicals have a broad antibody databasecovering the area of autophagy - over 1400 reagents in total. Autophagy is bulk degradation of cytoplasmic components - literally, self-digestion of the cell. Double-membrane vesicles, called autop...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LC3B Antibody (4E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP1LC3B
Entrez
Uniprot