LAMC2 Antibody

Images

 
Immunohistochemistry: LAMC2 Antibody [NBP1-88576] - Staining of human oral mucosa shows distinct positivity in basement membrane of squamous epithelia.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAMC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLEN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LAMC2 Protein (NBP1-88576PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAMC2 Antibody

  • BM600
  • BM600-100kDa
  • Cell-scattering factor 140 kDa subunit
  • CSF 140 kDa subunit
  • CSF
  • EBR2
  • EBR2A
  • Epiligrin subunit gamma
  • kalinin (105kD)
  • Kalinin subunit gamma
  • Kalinin/nicein/epiligrin 100 kDa subunit
  • kalinin-105kDa
  • ladsin (140kDa)
  • Ladsin 140 kDa subunit
  • LAMB2Tlaminin, gamma 2 (nicein (100kD), kalinin (105kD), BM600 (100kD), Herlitzjunctional epidermolysis bullosa))
  • Laminin B2t chain
  • laminin subunit gamma-2
  • laminin, gamma 2
  • Laminin-5 subunit gamma
  • LAMNB2B2T
  • Large adhesive scatter factor 140 kDa subunit
  • MGC138491
  • MGC141938
  • nicein (100kDa)
  • Nicein subunit gamma
  • nicein-100kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-88576
Species: Hu
Applications: IHC, IHC-P

Publications for LAMC2 Antibody (NBP1-88576) (0)

There are no publications for LAMC2 Antibody (NBP1-88576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAMC2 Antibody (NBP1-88576) (0)

There are no reviews for LAMC2 Antibody (NBP1-88576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LAMC2 Antibody (NBP1-88576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAMC2 Products

Bioinformatics Tool for LAMC2 Antibody (NBP1-88576)

Discover related pathways, diseases and genes to LAMC2 Antibody (NBP1-88576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAMC2 Antibody (NBP1-88576)

Discover more about diseases related to LAMC2 Antibody (NBP1-88576).
 

Pathways for LAMC2 Antibody (NBP1-88576)

View related products by pathway.

PTMs for LAMC2 Antibody (NBP1-88576)

Learn more about PTMs related to LAMC2 Antibody (NBP1-88576).

Blogs on LAMC2

There are no specific blogs for LAMC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAMC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMC2