LAF4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LAF4 Antibody [NBP1-87714] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: LAF4 Antibody [NBP1-87714] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QSHLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AFF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LAF4 Protein (NBP1-87714PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAF4 Antibody

  • AF4/FMR2 family, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
MAB666
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00085403-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
366-6C/CF
Species: Hu
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NB100-1566
Species: Hu
Applications: WB, IP
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P

Publications for LAF4 Antibody (NBP1-87714) (0)

There are no publications for LAF4 Antibody (NBP1-87714).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAF4 Antibody (NBP1-87714) (0)

There are no reviews for LAF4 Antibody (NBP1-87714). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LAF4 Antibody (NBP1-87714) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAF4 Products

Bioinformatics Tool for LAF4 Antibody (NBP1-87714)

Discover related pathways, diseases and genes to LAF4 Antibody (NBP1-87714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAF4 Antibody (NBP1-87714)

Discover more about diseases related to LAF4 Antibody (NBP1-87714).
 

Pathways for LAF4 Antibody (NBP1-87714)

View related products by pathway.

PTMs for LAF4 Antibody (NBP1-87714)

Learn more about PTMs related to LAF4 Antibody (NBP1-87714).

Blogs on LAF4

There are no specific blogs for LAF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AFF3