LAD1 Antibody

Images

 
Orthogonal Strategies: Western Blot: LAD1 Antibody [NBP1-85945] - Western blot analysis in human cell lines A-431 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: LAD1 Antibody [NBP1-85945] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LAD1 Antibody [NBP1-85945] - Immunohistochemistry analysis in human kidney and cerebral cortex tissues. Corresponding RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: LAD1 Antibody [NBP1-85945] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: LAD1 Antibody [NBP1-85945] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: LAD1 Antibody [NBP1-85945] - Staining of human kidney shows moderate to strong positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKTSISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVSEKSLAP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LAD1 Protein (NBP1-85945PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAD1 Antibody

  • LAD
  • lad-1
  • LadA
  • ladinin 1
  • ladinin-1
  • linear IgA bullous dermatosis antigen
  • linear IgA disease antigen homolog
  • Linear IgA disease antigen
  • MGC10355

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-11863
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-IC
MAB1417
Species: Hu, Mu, Bv
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB1266
Species: Hu
Applications: WB, IP, CyTOF-ready, ICFlow
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-46629
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-48272
Species: Hu, Mu, Rt, Pm, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
H00003033-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85892
Species: Hu
Applications: IHC, IHC-P
NBP1-85945
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LAD1 Antibody (NBP1-85945) (0)

There are no publications for LAD1 Antibody (NBP1-85945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAD1 Antibody (NBP1-85945) (0)

There are no reviews for LAD1 Antibody (NBP1-85945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LAD1 Antibody (NBP1-85945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LAD1 Products

Array NBP1-85945

Bioinformatics Tool for LAD1 Antibody (NBP1-85945)

Discover related pathways, diseases and genes to LAD1 Antibody (NBP1-85945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAD1 Antibody (NBP1-85945)

Discover more about diseases related to LAD1 Antibody (NBP1-85945).
 

Pathways for LAD1 Antibody (NBP1-85945)

View related products by pathway.

PTMs for LAD1 Antibody (NBP1-85945)

Learn more about PTMs related to LAD1 Antibody (NBP1-85945).

Blogs on LAD1

There are no specific blogs for LAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAD1