Lactate Dehydrogenase B Antibody (2F11)

Images

 
Sandwich ELISA: Lactate Dehydrogenase B Antibody (2F11) [H00003945-M02] - Detection limit for recombinant GST tagged LDHB is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lactate Dehydrogenase B Antibody (2F11) Summary

Immunogen
LDHB (AAH02362.1, 1 a.a. - 334 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Specificity
LDHB - lactate dehydrogenase B (2F11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LDHB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lactate Dehydrogenase B Antibody (2F11)

  • EC 1.1.1
  • EC 1.1.1.27
  • Epididymis Secretory Protein Li 281
  • HEL-S-281
  • Lactate Dehydrogenase B
  • LDH heart subunit
  • LDHB
  • LDH-B
  • LDHBD
  • LDH-H
  • L-lactate dehydrogenase B chain
  • Renal Carcinoma Antigen NY-REN-46
  • TRG-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54755
Species: Hu
Applications: WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34980
Species: Hu
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
H00003945-M02
Species: Hu
Applications: WB, ELISA

Publications for Lactate Dehydrogenase B Antibody (H00003945-M02) (0)

There are no publications for Lactate Dehydrogenase B Antibody (H00003945-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactate Dehydrogenase B Antibody (H00003945-M02) (0)

There are no reviews for Lactate Dehydrogenase B Antibody (H00003945-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lactate Dehydrogenase B Antibody (H00003945-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lactate Dehydrogenase B Products

Bioinformatics Tool for Lactate Dehydrogenase B Antibody (H00003945-M02)

Discover related pathways, diseases and genes to Lactate Dehydrogenase B Antibody (H00003945-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactate Dehydrogenase B Antibody (H00003945-M02)

Discover more about diseases related to Lactate Dehydrogenase B Antibody (H00003945-M02).
 

Pathways for Lactate Dehydrogenase B Antibody (H00003945-M02)

View related products by pathway.

PTMs for Lactate Dehydrogenase B Antibody (H00003945-M02)

Learn more about PTMs related to Lactate Dehydrogenase B Antibody (H00003945-M02).
 

Research Areas for Lactate Dehydrogenase B Antibody (H00003945-M02)

Find related products by research area.

Blogs on Lactate Dehydrogenase B

There are no specific blogs for Lactate Dehydrogenase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lactate Dehydrogenase B Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHB
Entrez
Uniprot