Lactase Antibody

Images

 
Immunohistochemistry-Paraffin: Lactase Antibody [NBP1-87586] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry: Lactase Antibody [NBP1-87586] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lactase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KELPHQESRASQLQTLSDAHRKAYEIYHESYAFQGGKLSVVLRAEDIPELLLEPPISALAQDTVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFNLKLPDCPSTMKNPASLLFSLFEAINKDQVLTIGFDINEFLSCSSSSKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lactase Protein (NBP1-87586PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lactase Antibody

  • EC 3.2.1
  • LAC
  • lactase
  • Lactase-glycosylceramidase
  • lactase-phlorizin hydrolase
  • LPH1
  • LPHlactase-phlorizin hydrolase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87586
Species: Hu
Applications: IHC, IHC-P

Publications for Lactase Antibody (NBP1-87586) (0)

There are no publications for Lactase Antibody (NBP1-87586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactase Antibody (NBP1-87586) (0)

There are no reviews for Lactase Antibody (NBP1-87586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lactase Antibody (NBP1-87586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lactase Products

Bioinformatics Tool for Lactase Antibody (NBP1-87586)

Discover related pathways, diseases and genes to Lactase Antibody (NBP1-87586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactase Antibody (NBP1-87586)

Discover more about diseases related to Lactase Antibody (NBP1-87586).
 

Pathways for Lactase Antibody (NBP1-87586)

View related products by pathway.

PTMs for Lactase Antibody (NBP1-87586)

Learn more about PTMs related to Lactase Antibody (NBP1-87586).

Blogs on Lactase

There are no specific blogs for Lactase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lactase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCT