Kv6.4 Antibody

Images

 
Western Blot: Kv6.4 Antibody [NBP1-81335] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: Kv6.4 Antibody [NBP1-81335] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Kv6.4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKEILINVGGRRYLLPWSTLDRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
Kv6.4 Protein (NBP1-81335PEP)

Alternate Names for Kv6.4 Antibody

  • KV6.3
  • KV6.4
  • MGC129609
  • potassium voltage-gated channel, subfamily G, member 4
  • voltage-gated potassium channel Kv6.3
  • voltage-gated potassium channel subunit Kv6.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-84935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81605
Species: Hu
Applications: IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-66555
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82860
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14141
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP2-38797
Species: Hu
Applications: IHC, IHC-P
NBP1-81572
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8218
Species: Hu
Applications: WB, IHC
NB120-2941
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P

Publications for Kv6.4 Antibody (NBP1-81335) (0)

There are no publications for Kv6.4 Antibody (NBP1-81335).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv6.4 Antibody (NBP1-81335) (0)

There are no reviews for Kv6.4 Antibody (NBP1-81335). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv6.4 Antibody (NBP1-81335) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv6.4 Antibody Products

Related Products by Gene

Bioinformatics Tool for Kv6.4 Antibody (NBP1-81335)

Discover related pathways, diseases and genes to Kv6.4 Antibody (NBP1-81335). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv6.4 Antibody (NBP1-81335)

Discover more about diseases related to Kv6.4 Antibody (NBP1-81335).
 

Pathways for Kv6.4 Antibody (NBP1-81335)

View related products by pathway.

Blogs on Kv6.4

There are no specific blogs for Kv6.4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol KCNG4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81335 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought