Kv6.4 Antibody

Images

 
Western Blot: Kv6.4 Antibody [NBP1-81335] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: Kv6.4 Antibody [NBP1-81335] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv6.4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKEILINVGGRRYLLPWSTLDRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
Kv6.4 Protein (NBP1-81335PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv6.4 Antibody

  • KV6.3
  • KV6.4
  • MGC129609
  • potassium voltage-gated channel, subfamily G, member 4
  • voltage-gated potassium channel Kv6.3
  • voltage-gated potassium channel subunit Kv6.4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-84935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81605
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-82860
Species: Hu
Applications: IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
355-BM/CF
Species: Hu, Mu, Rt
NBP2-14141
Species: Hu
Applications: IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
H00003757-R07
Species: Hu
NBP1-81572
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8218
Species: Hu
Applications: WB, IHC
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-81335
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Kv6.4 Antibody (NBP1-81335) (0)

There are no publications for Kv6.4 Antibody (NBP1-81335).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv6.4 Antibody (NBP1-81335) (0)

There are no reviews for Kv6.4 Antibody (NBP1-81335). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv6.4 Antibody (NBP1-81335) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv6.4 Products

Bioinformatics Tool for Kv6.4 Antibody (NBP1-81335)

Discover related pathways, diseases and genes to Kv6.4 Antibody (NBP1-81335). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv6.4 Antibody (NBP1-81335)

Discover more about diseases related to Kv6.4 Antibody (NBP1-81335).
 

Pathways for Kv6.4 Antibody (NBP1-81335)

View related products by pathway.

Blogs on Kv6.4

There are no specific blogs for Kv6.4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv6.4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNG4