Kv3.3 Antibody (1C1) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Kv3.3 Primary Antibodies

Order Details


    • Catalog Number
      H00003748-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Kv3.3 Antibody (1C1) [PerCP] Summary

Immunogen
KCNC3 (NP_004968 671 a.a. - 757 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Specificity
KCNC3 (1C1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv3.3 Antibody (1C1) [PerCP]

  • KSHIIID
  • KV3.3
  • potassium voltage-gated channel subfamily C member 3
  • potassium voltage-gated channel, Shaw-related subfamily, member 3
  • SCA13
  • Shaw-related voltage-gated potassium channel protein 3
  • spinocerebellar ataxia 13
  • voltage-gated potassium channel protein KV3.3
  • Voltage-gated potassium channel subunit Kv3.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-59328
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5130
Species: Hu, Mu, Rt
Applications: WB
NBP1-92476
Species: Hu
Applications: IHC, IHC-P
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-55745
Species: Hu
Applications: ICC/IF
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
H00003748-M01PCP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for Kv3.3 Antibody (H00003748-M01PCP) (0)

There are no publications for Kv3.3 Antibody (H00003748-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv3.3 Antibody (H00003748-M01PCP) (0)

There are no reviews for Kv3.3 Antibody (H00003748-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Kv3.3 Antibody (H00003748-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv3.3 Products

Bioinformatics Tool for Kv3.3 Antibody (H00003748-M01PCP)

Discover related pathways, diseases and genes to Kv3.3 Antibody (H00003748-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.3 Antibody (H00003748-M01PCP)

Discover more about diseases related to Kv3.3 Antibody (H00003748-M01PCP).
 

Pathways for Kv3.3 Antibody (H00003748-M01PCP)

View related products by pathway.

PTMs for Kv3.3 Antibody (H00003748-M01PCP)

Learn more about PTMs related to Kv3.3 Antibody (H00003748-M01PCP).
 

Research Areas for Kv3.3 Antibody (H00003748-M01PCP)

Find related products by research area.

Blogs on Kv3.3

There are no specific blogs for Kv3.3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv3.3 Antibody (1C1) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNC3