Kv3.2 Antibody

Images

 
Western Blot: Kv3.2 Antibody [NBP1-87707] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: Kv3.2 Antibody [NBP1-87707] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv3.2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv3.2 Protein (NBP1-87707PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv3.2 Antibody

  • Kv3.2
  • MGC138196
  • potassium voltage-gated channel subfamily C member 2
  • potassium voltage-gated channel, Shaw-related subfamily, member 2
  • Voltage-gated potassium channel Kv3.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
H00003738-M01
Species: Hu
Applications: WB, ELISA
H00003736-B01P
Species: Hu
Applications: WB
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
PPS015
Species: Rt, Xp
Applications: WB, IHC
NBP1-89717
Species: Hu
Applications: IHC, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42788
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, IP

Publications for Kv3.2 Antibody (NBP1-87707) (0)

There are no publications for Kv3.2 Antibody (NBP1-87707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv3.2 Antibody (NBP1-87707) (0)

There are no reviews for Kv3.2 Antibody (NBP1-87707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv3.2 Antibody (NBP1-87707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv3.2 Products

Bioinformatics Tool for Kv3.2 Antibody (NBP1-87707)

Discover related pathways, diseases and genes to Kv3.2 Antibody (NBP1-87707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.2 Antibody (NBP1-87707)

Discover more about diseases related to Kv3.2 Antibody (NBP1-87707).
 

Pathways for Kv3.2 Antibody (NBP1-87707)

View related products by pathway.

Blogs on Kv3.2

There are no specific blogs for Kv3.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv3.2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNC2