Ku70/XRCC6 Antibody

Images

 
Western Blot: Ku70/XRCC6 Antibody [NBP1-53009] - HepG2 cell lysate, Antibody Titration: 0.6ug/ml
Immunohistochemistry: Ku70/XRCC6 Antibody [NBP1-53009] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP1-53009] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Immunohistochemistry-Paraffin: Ku70/XRCC6 Antibody [NBP1-53009] - Human kidney tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Product Discontinued
View other related Ku70/XRCC6 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53009
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ku70/XRCC6 Antibody Summary

Immunogen
Synthetic peptides corresponding to G22P1 The peptide sequence was selected from the N terminal of G22P1. Peptide sequence NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL.
Clonality
Polyclonal
Host
Rabbit
Gene
XRCC6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against G22P1 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ku70/XRCC6 Antibody

  • 5'-deoxyribose-5-phosphate lyase Ku70
  • 5'-dRP lyase Ku70
  • 70 kDa subunit of Ku antigen
  • ATP-dependent DNA helicase 2 subunit 1
  • ATP-dependent DNA helicase II 70 kDa subunit
  • CTC box binding factor 75 kDa subunit
  • CTC box-binding factor 75 kDa subunit
  • CTC75
  • CTCBF
  • D22S731
  • EC 3.6.4.-
  • EC 4.2.99.-
  • G22P1
  • G22P1Ku70
  • Ku autoantigen p70 subunit
  • Ku autoantigen, 70kDa
  • Ku70
  • ML8
  • ML8,70 kDa subunit
  • thyroid-lupus autoantigen p70
  • Thyroid-lupus autoantigen
  • TLAA
  • TLAAD22S671
  • X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6
  • X-ray repair cross-complementing protein 6
  • XRCC6

Background

The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48053
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-183
Species: Hu
Applications: WB
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP1-53009
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ku70/XRCC6 Antibody (NBP1-53009) (0)

There are no publications for Ku70/XRCC6 Antibody (NBP1-53009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ku70/XRCC6 Antibody (NBP1-53009) (0)

There are no reviews for Ku70/XRCC6 Antibody (NBP1-53009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ku70/XRCC6 Antibody (NBP1-53009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ku70/XRCC6 Products

Bioinformatics Tool for Ku70/XRCC6 Antibody (NBP1-53009)

Discover related pathways, diseases and genes to Ku70/XRCC6 Antibody (NBP1-53009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ku70/XRCC6 Antibody (NBP1-53009)

Discover more about diseases related to Ku70/XRCC6 Antibody (NBP1-53009).
 

Pathways for Ku70/XRCC6 Antibody (NBP1-53009)

View related products by pathway.

PTMs for Ku70/XRCC6 Antibody (NBP1-53009)

Learn more about PTMs related to Ku70/XRCC6 Antibody (NBP1-53009).
 

Research Areas for Ku70/XRCC6 Antibody (NBP1-53009)

Find related products by research area.

Blogs on Ku70/XRCC6

There are no specific blogs for Ku70/XRCC6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ku70/XRCC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC6
Entrez
Uniprot