Ku70/XRCC6 Antibody


Western Blot: Ku70/XRCC6 Antibody [NBP1-53008] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Product Discontinued
View other related Ku70/XRCC6 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ku70/XRCC6 Antibody Summary

Synthetic peptides corresponding to G22P1 The peptide sequence was selected from the N terminal of G22P1. Peptide sequence MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against G22P1 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ku70/XRCC6 Antibody

  • 5'-deoxyribose-5-phosphate lyase Ku70
  • 5'-dRP lyase Ku70
  • 70 kDa subunit of Ku antigen
  • ATP-dependent DNA helicase 2 subunit 1
  • ATP-dependent DNA helicase II 70 kDa subunit
  • CTC box binding factor 75 kDa subunit
  • CTC box-binding factor 75 kDa subunit
  • CTC75
  • D22S731
  • EC 3.6.4.-
  • EC 4.2.99.-
  • G22P1
  • G22P1Ku70
  • Ku autoantigen p70 subunit
  • Ku autoantigen, 70kDa
  • Ku70
  • ML8
  • ML8,70 kDa subunit
  • thyroid-lupus autoantigen p70
  • Thyroid-lupus autoantigen
  • TLAA
  • TLAAD22S671
  • X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6
  • X-ray repair cross-complementing protein 6
  • XRCC6


The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
Species: Hu
Applications: WB

Publications for Ku70/XRCC6 Antibody (NBP1-53008) (0)

There are no publications for Ku70/XRCC6 Antibody (NBP1-53008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ku70/XRCC6 Antibody (NBP1-53008) (0)

There are no reviews for Ku70/XRCC6 Antibody (NBP1-53008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ku70/XRCC6 Antibody (NBP1-53008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Ku70/XRCC6 Products

Bioinformatics Tool for Ku70/XRCC6 Antibody (NBP1-53008)

Discover related pathways, diseases and genes to Ku70/XRCC6 Antibody (NBP1-53008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ku70/XRCC6 Antibody (NBP1-53008)

Discover more about diseases related to Ku70/XRCC6 Antibody (NBP1-53008).

Pathways for Ku70/XRCC6 Antibody (NBP1-53008)

View related products by pathway.

PTMs for Ku70/XRCC6 Antibody (NBP1-53008)

Learn more about PTMs related to Ku70/XRCC6 Antibody (NBP1-53008).

Research Areas for Ku70/XRCC6 Antibody (NBP1-53008)

Find related products by research area.

Blogs on Ku70/XRCC6

There are no specific blogs for Ku70/XRCC6, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ku70/XRCC6 Antibody and receive a gift card or discount.


Gene Symbol XRCC6