KRTAP24-1 Antibody


Immunohistochemistry-Paraffin: KRTAP24-1 Antibody [NBP2-55326] - Staining of human hair shows strong cytoplasmic positivity in cuticle layer.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

KRTAP24-1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSMSTTGYPGVCSTTSYRTHCYIPVTSSVTLSSSDLSPTFGHCLPSSYQGNLWLLDYCQESYGEAPTCKSPS
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRTAP24-1 Recombinant Protein Antigen (NBP2-55326PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for KRTAP24-1 Antibody

  • KAP24.1
  • keratin associated protein 24-1
  • keratin-associated protein 24-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB

Publications for KRTAP24-1 Antibody (NBP2-55326) (0)

There are no publications for KRTAP24-1 Antibody (NBP2-55326).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRTAP24-1 Antibody (NBP2-55326) (0)

There are no reviews for KRTAP24-1 Antibody (NBP2-55326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRTAP24-1 Antibody (NBP2-55326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KRTAP24-1 Products

Bioinformatics Tool for KRTAP24-1 Antibody (NBP2-55326)

Discover related pathways, diseases and genes to KRTAP24-1 Antibody (NBP2-55326). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRTAP24-1

There are no specific blogs for KRTAP24-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KRTAP24-1 Antibody and receive a gift card or discount.


Gene Symbol KRTAP24-1