KRT82 Antibody

Images

 
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Staining of colon.
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Staining of human skin shows strong cytoplasmic positivity in stratum granulosum.
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Staining of human skin shows strong cytoplasmic positivity in stratum granulosum.
Immunohistochemistry: KRT82 Antibody [NBP2-31895] - Staining of skin cancer

Product Details

Summary
Product Discontinued
View other related KRT82 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31895
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KRT82 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT82
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KRT82 Antibody

  • Hard Keratin, Type II, 2
  • HB2
  • Hb-2
  • K82
  • keratin 82
  • Keratin, Hair, Basic, 2
  • Keratin, Type II Cuticular Hb2
  • Keratin-82
  • KRTHB2
  • Type II Hair Keratin Hb2
  • Type-II Keratin Kb22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003887-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBL1-12400
Species: Hu
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
645-WN/CF
Species: Hu, Mu
H00003889-B01P
Species: Hu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31895
Species: Hu
Applications: IHC, IHC-P

Publications for KRT82 Antibody (NBP2-31895) (0)

There are no publications for KRT82 Antibody (NBP2-31895).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT82 Antibody (NBP2-31895) (0)

There are no reviews for KRT82 Antibody (NBP2-31895). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRT82 Antibody (NBP2-31895) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRT82 Products

KRT82 NBP2-31895

Bioinformatics Tool for KRT82 Antibody (NBP2-31895)

Discover related pathways, diseases and genes to KRT82 Antibody (NBP2-31895). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT82

There are no specific blogs for KRT82, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT82 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT82
Uniprot