KRAS Antibody

Product Discontinued

KRAS Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human KRAS (NP_203524). Peptide sequence TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC.
• Predicted Species: Rat (100%), Canine (100%), Equine (100%), Yeast (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%), Zebrafish (100%). Backed by our 100% Guarantee.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRAS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against KRAS and was validated on Western blot.
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28460446).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: LYOPH
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KRAS Antibody

• cellular c-Ki-ras2 proto-oncogene
• c-Ki-ras
• C-K-RAS
• GTPase KRas
• KI-RAS
• Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog
• K-Ras 2
• K-ras p21 protein
• KRAS1
• K-RAS2A
• K-RAS2B
• KRAS2NS3
• K-RAS4A
• K-RAS4B
• NS
• oncogene KRAS2
• PR310 c-K-ras oncogene
• RASK2c-Kirsten-ras protein
• transforming protein p21
• v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog
• v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog

Background

KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KRAS Antibody (NBP1-58261)(1)

Publication using NBP1-58261

• Kapil S, Sharma BK, Patil M et al. The cell polarity protein Scrib functions as a tumor suppressor in liver cancer. Oncotarget 2017-04-18 [PMID: 28460446] (WB, Mouse)
  
  Details:
  This KRAS antibody was used to examine differences in expression of KRAS in control cells vs Scrib-OE Huh-7 cells

Bioinformatics

• Gene Symbol: KRAS
• Entrez:
  • 3845(Human)
• Uniprot:
  • P01111(Human)