KLHDC2 Antibody

Images

 
Western Blot: KLHDC2 Antibody [NBP1-55419] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related KLHDC2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55419
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KLHDC2 Antibody Summary

Immunogen
Synthetic peptides corresponding to KLHDC2(kelch domain containing 2) The peptide sequence was selected from the N terminal of KLHDC2. Peptide sequence VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KLHDC2 and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHDC2 Antibody

  • HCA33
  • HCLP-1Host cell factor-like protein 1
  • Hepatocellular carcinoma-associated antigen 33
  • Host cell factor homolog LCP
  • kelch domain containing 2
  • kelch domain-containing protein 2
  • LCP

Background

KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-DNA binding. It contains 6 Kelch repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00010488-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
NBP2-77359
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
2367-FC
Species: Hu
Applications: Bind
NB100-68210
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-81208
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF6465
Species: Hu, Rt
Applications: ICC, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-76910
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
AF1724
Species: Hu
Applications: IP, WB
NBP2-32822
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for KLHDC2 Antibody (NBP1-55419) (0)

There are no publications for KLHDC2 Antibody (NBP1-55419).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHDC2 Antibody (NBP1-55419) (0)

There are no reviews for KLHDC2 Antibody (NBP1-55419). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHDC2 Antibody (NBP1-55419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHDC2 Products

Bioinformatics Tool for KLHDC2 Antibody (NBP1-55419)

Discover related pathways, diseases and genes to KLHDC2 Antibody (NBP1-55419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHDC2 Antibody (NBP1-55419)

Discover more about diseases related to KLHDC2 Antibody (NBP1-55419).
 

Pathways for KLHDC2 Antibody (NBP1-55419)

View related products by pathway.

Blogs on KLHDC2

There are no specific blogs for KLHDC2, but you can read our latest blog posts.
Omicron Variant Antibodies

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHDC2
Uniprot