Recombinant Human KLF6 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related KLF6 Peptides and Proteins

Order Details


    • Catalog Number
      H00001316-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human KLF6 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human KLF6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE

Protein/Peptide Type
Partial Recombinant Protein
Gene
KLF6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLF6 Protein

  • BCD1
  • BCD1Zf9
  • B-cell-derived protein 1
  • COPEB
  • COPEBCBA1
  • core promoter element binding protein
  • Core promoter element-binding protein
  • CPBP
  • CPBPZF9
  • DKFZp686N0199
  • EC 2.1.1.43
  • EC 6.1.1.15
  • GBF
  • GC-rich binding factor
  • GC-rich sites-binding factor GBF
  • KLF6
  • Krueppel-like factor 6
  • Kruppel-like factor 6
  • Kruppel-like zinc finger protein Zf9
  • PAC1
  • Proto-oncogene BCD1
  • protooncogene B-cell derived 1
  • ST12
  • suppression of tumorigenicity 12 (prostate)
  • Suppressor of tumorigenicity 12 protein
  • Transcription factor Zf9

Background

KLF6 - Kruppel-like factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6380
Species: Mu
Applications: WB
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89640
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5416
Species: Hu
Applications: IHC
NLS948
Species: Hu, Bt, Ca, Ch, Mk, Pm, Xp
Applications: IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-46085
Species: Hu
Applications: WB, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for KLF6 Partial Recombinant Protein (H00001316-Q01) (0)

There are no publications for KLF6 Partial Recombinant Protein (H00001316-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF6 Partial Recombinant Protein (H00001316-Q01) (0)

There are no reviews for KLF6 Partial Recombinant Protein (H00001316-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF6 Partial Recombinant Protein (H00001316-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLF6 Products

Bioinformatics Tool for KLF6 Partial Recombinant Protein (H00001316-Q01)

Discover related pathways, diseases and genes to KLF6 Partial Recombinant Protein (H00001316-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF6 Partial Recombinant Protein (H00001316-Q01)

Discover more about diseases related to KLF6 Partial Recombinant Protein (H00001316-Q01).
 

Pathways for KLF6 Partial Recombinant Protein (H00001316-Q01)

View related products by pathway.

PTMs for KLF6 Partial Recombinant Protein (H00001316-Q01)

Learn more about PTMs related to KLF6 Partial Recombinant Protein (H00001316-Q01).
 

Research Areas for KLF6 Partial Recombinant Protein (H00001316-Q01)

Find related products by research area.

Blogs on KLF6

There are no specific blogs for KLF6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLF6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF6
Entrez