KLF6 Antibody (3C4) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related KLF6 Primary Antibodies

Order Details


    • Catalog Number
      H00001316-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KLF6 Antibody (3C4) [PE] Summary

Immunogen
KLF6 (NP_001291, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLE
Specificity
KLF6 - Kruppel-like factor 6
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KLF6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KLF6 Antibody (3C4) [PE]

  • BCD1
  • BCD1Zf9
  • B-cell-derived protein 1
  • COPEB
  • COPEBCBA1
  • core promoter element binding protein
  • Core promoter element-binding protein
  • CPBP
  • CPBPZF9
  • DKFZp686N0199
  • EC 2.1.1.43
  • EC 6.1.1.15
  • GBF
  • GC-rich binding factor
  • GC-rich sites-binding factor GBF
  • KLF6
  • Krueppel-like factor 6
  • Kruppel-like factor 6
  • Kruppel-like zinc finger protein Zf9
  • PAC1
  • Proto-oncogene BCD1
  • protooncogene B-cell derived 1
  • ST12
  • suppression of tumorigenicity 12 (prostate)
  • Suppressor of tumorigenicity 12 protein
  • Transcription factor Zf9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6380
Species: Mu
Applications: WB
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89640
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5416
Species: Hu
Applications: IHC
NLS948
Species: Hu, Bt, Ca, Ch, Mk, Pm, Xp
Applications: IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-46085
Species: Hu
Applications: WB, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for KLF6 Antibody (H00001316-M02PE) (0)

There are no publications for KLF6 Antibody (H00001316-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF6 Antibody (H00001316-M02PE) (0)

There are no reviews for KLF6 Antibody (H00001316-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLF6 Antibody (H00001316-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF6 Products

Bioinformatics Tool for KLF6 Antibody (H00001316-M02PE)

Discover related pathways, diseases and genes to KLF6 Antibody (H00001316-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF6 Antibody (H00001316-M02PE)

Discover more about diseases related to KLF6 Antibody (H00001316-M02PE).
 

Pathways for KLF6 Antibody (H00001316-M02PE)

View related products by pathway.

PTMs for KLF6 Antibody (H00001316-M02PE)

Learn more about PTMs related to KLF6 Antibody (H00001316-M02PE).
 

Research Areas for KLF6 Antibody (H00001316-M02PE)

Find related products by research area.

Blogs on KLF6

There are no specific blogs for KLF6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF6 Antibody (3C4) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF6
Entrez