Recombinant Human KLF4 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related KLF4 Peptides and Proteins

Order Details


    • Catalog Number
      H00009314-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human KLF4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 221-320 of Human KLF4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
KLF4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLF4 Protein

  • Epithelial zinc finger protein EZF
  • EZF
  • EZFendothelial Kruppel-like zinc finger protein
  • GKLFKrueppel-like factor 4
  • Gut-enriched krueppel-like factor
  • KLF4
  • Kruppel-like factor 4 (gut)

Background

KLF4 - Kruppel-like factor 4 (gut)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF1997
Species: Hu
Applications: WB, ChIP, ICC
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3757
Species: Hu
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-46085
Species: Hu
Applications: WB, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for KLF4 Partial Recombinant Protein (H00009314-Q01) (0)

There are no publications for KLF4 Partial Recombinant Protein (H00009314-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF4 Partial Recombinant Protein (H00009314-Q01) (0)

There are no reviews for KLF4 Partial Recombinant Protein (H00009314-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF4 Partial Recombinant Protein (H00009314-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLF4 Products

Bioinformatics Tool for KLF4 Partial Recombinant Protein (H00009314-Q01)

Discover related pathways, diseases and genes to KLF4 Partial Recombinant Protein (H00009314-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF4 Partial Recombinant Protein (H00009314-Q01)

Discover more about diseases related to KLF4 Partial Recombinant Protein (H00009314-Q01).
 

Pathways for KLF4 Partial Recombinant Protein (H00009314-Q01)

View related products by pathway.

PTMs for KLF4 Partial Recombinant Protein (H00009314-Q01)

Learn more about PTMs related to KLF4 Partial Recombinant Protein (H00009314-Q01).
 

Research Areas for KLF4 Partial Recombinant Protein (H00009314-Q01)

Find related products by research area.

Blogs on KLF4.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

KLF4 opens the door for stem cell research
KLF4 (Kruppel-like factor 4, Epithelial zinc finger protein EZF) is a zinc finger transcription factor thought to be involved in developmental differentiation and proliferation. It is considered a pluripotency reprogramming factor (PRF) due to its abi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLF4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF4
Entrez