KLF4 Antibody

Images

 
Western Blot: KLF4 Antibody [NBP1-69120] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.

Product Details

Summary
Product Discontinued
View other related KLF4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69120
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KLF4 Antibody Summary

Immunogen
Synthetic peptides corresponding to Klf4 (Kruppel-like factor 4 (gut)) The peptide sequence was selected from the N terminal of Klf4. Peptide sequence MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH.
Clonality
Polyclonal
Host
Rabbit
Gene
KLF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Klf4 and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLF4 Antibody

  • Epithelial zinc finger protein EZF
  • EZF
  • EZFendothelial Kruppel-like zinc finger protein
  • GKLFKrueppel-like factor 4
  • Gut-enriched krueppel-like factor
  • KLF4
  • Kruppel-like factor 4 (gut)

Background

The function of Klf4 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF1997
Species: Hu
Applications: WB, ChIP, ICC
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3757
Species: Hu
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-46085
Species: Hu
Applications: WB, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for KLF4 Antibody (NBP1-69120) (0)

There are no publications for KLF4 Antibody (NBP1-69120).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF4 Antibody (NBP1-69120) (0)

There are no reviews for KLF4 Antibody (NBP1-69120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF4 Antibody (NBP1-69120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF4 Products

Bioinformatics Tool for KLF4 Antibody (NBP1-69120)

Discover related pathways, diseases and genes to KLF4 Antibody (NBP1-69120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF4 Antibody (NBP1-69120)

Discover more about diseases related to KLF4 Antibody (NBP1-69120).
 

Pathways for KLF4 Antibody (NBP1-69120)

View related products by pathway.

PTMs for KLF4 Antibody (NBP1-69120)

Learn more about PTMs related to KLF4 Antibody (NBP1-69120).

Blogs on KLF4.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

KLF4 opens the door for stem cell research
KLF4 (Kruppel-like factor 4, Epithelial zinc finger protein EZF) is a zinc finger transcription factor thought to be involved in developmental differentiation and proliferation. It is considered a pluripotency reprogramming factor (PRF) due to its abi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF4
Entrez