KLF15 Antibody

Images

 
Immunohistochemistry-Paraffin: KLF15 Antibody [NBP1-82872] - Staining of human liver shows few nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: KLF15 Antibody [NBP1-82872] - Staining of human kidney shows moderate to strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: KLF15 Antibody [NBP1-82872] - Staining of human cerebellum shows moderate to strong nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLF15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLF15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
KLF15 Protein (NBP1-82872PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLF15 Antibody

  • DKFZp779M1320
  • kidney-enriched Kruppel-like factor
  • KKLFKidney-enriched krueppel-like factor
  • Krueppel-like factor 15
  • Kruppel-like factor 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-46842
Species: Hu
Applications: IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33519
Species: Hu
Applications: WB, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC
AF2945
Species: Hu
Applications: WB
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
H00001188-P01
Species: Hu
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC

Publications for KLF15 Antibody (NBP1-82872) (0)

There are no publications for KLF15 Antibody (NBP1-82872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF15 Antibody (NBP1-82872) (0)

There are no reviews for KLF15 Antibody (NBP1-82872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KLF15 Antibody (NBP1-82872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLF15 Products

Bioinformatics Tool for KLF15 Antibody (NBP1-82872)

Discover related pathways, diseases and genes to KLF15 Antibody (NBP1-82872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF15 Antibody (NBP1-82872)

Discover more about diseases related to KLF15 Antibody (NBP1-82872).
 

Pathways for KLF15 Antibody (NBP1-82872)

View related products by pathway.

PTMs for KLF15 Antibody (NBP1-82872)

Learn more about PTMs related to KLF15 Antibody (NBP1-82872).

Blogs on KLF15

There are no specific blogs for KLF15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLF15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF15